SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|325972368|ref|YP_004248559.1| from Sphaerochaeta globus str. Buddy

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325972368|ref|YP_004248559.1|
Domain Number 1 Region: 54-104
Classification Level Classification E-value
Superfamily LCCL domain 0.0000432
Family LCCL domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|325972368|ref|YP_004248559.1|
Sequence length 351
Comment hypothetical protein [Sphaerochaeta globosa str. Buddy]
Sequence
MKQRTLLVCILIVFALPLLPGSEVTSITWETTAQEYKGRYTEKITFQLPPNGTPKPVYGF
GEYAWNSSIGSAAVAMDLLTYKDGGTVTILIVEGPEYYKSGETYEGWNTTFVFLDAKGNI
IKPDEASIMYIDIPEEPFEPVSTPSPKSFTVSNNTGTTLTYLGIFSSDMRAVGVHKKNLL
ANERLPNGQSVQIYFAENPDLEAVILYRYGQVLQVDATAERQREFRYEWRPDTNNLQIIL
LPEHERKQKSLTSLAVINEGEYALVELYLLTPAMEAKRDYSKEILQGQVIRSGETCVIDL
MKWPYLRSFLEKQTQDLLSVEAYDEDGYPLFQFWLPEYENLEITLSDWDYL
Download sequence
Identical sequences F0RTC1
WP_013608210.1.37756 gi|325972368|ref|YP_004248559.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]