SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|305662508|ref|YP_003858796.1| from Ignisphaera aggregans DSM 17230

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|305662508|ref|YP_003858796.1|
Domain Number 1 Region: 308-468
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.34e-54
Family DNA gyrase/MutL, second domain 0.00000198
Further Details:      
 
Domain Number 2 Region: 17-228
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.96e-36
Family DNA gyrase/MutL, N-terminal domain 0.000000491
Further Details:      
 
Domain Number 3 Region: 231-303
Classification Level Classification E-value
Superfamily S13-like H2TH domain 0.00000000000379
Family Topoisomerase VI-B subunit middle domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|305662508|ref|YP_003858796.1|
Sequence length 528
Comment DNA topoisomerase VI subunit B [Ignisphaera aggregans DSM 17230]
Sequence
MSATAEKFRSISPAEFFYRNKEIAGFANPARALYQAVRELVENALDATDAHGILPNIEVS
IERDSVKQYVYRISVKDNGIGIPEKYIPEAFGKVLFSSKYVLRQTRGLFGLGAKMVILYG
QMTVGEPAEIISAAINSRRIYSYRIMIDVRENKPIIVSKGVWPNNTGWHGTMVKVAIEGD
WSRAKQKILDYIKRTAIVTPYANIVFKTPDGEIYTYLRVTETIPPPPRETKPHPHGVDLE
LIKTMISETKAQRLIDFISEEFQGVGNVIAERFLTKYGFDPSKDPKTLSKEELELLVKAL
KEFNEFRKPRADHLSPIGAELIKIGLNSILKPEFVDAVTRKPVVYEGHSIIVEVGIAYGG
SIQPSEEVVLLRYANKIPLLYDEKSDVAWKVVSENIDWSYYGIVFPAPLAILVHICGTKI
PYKGVGKESIAEVPVIEKEIEEGVRQVARSLKLYLARKQKEEEMMRKAVTIIKYVPEVAR
NLAVLSKANPVRIDEKELEMKIFELVKHKYGEYLNNISSPYDIVIGIE
Download sequence
Identical sequences E0SPH3
gi|305662508|ref|YP_003858796.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]