SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|305662808|ref|YP_003859096.1| from Ignisphaera aggregans DSM 17230

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|305662808|ref|YP_003859096.1|
Domain Number 1 Region: 3-250
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 3.84e-70
Family HpcH/HpaI aldolase 0.0000198
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|305662808|ref|YP_003859096.1|
Sequence length 253
Comment 2-dehydro-3-deoxyglucarate aldolase [Ignisphaera aggregans DSM 17230]
Sequence
MNLKQRMKKGDILLGTWITINHPDVVDALSELPFDWFVFDLEHAPLDISNLEILLMPLKN
TGIAPLARAPWNDMIWIKRILDVGVEGIVAPWINSGREAELFVKYATYPPKGLRGVGPRR
AIRYGNIRFDEYYKRFETEDRVLIAQIETRDAIENVEDIVSVDGIDGAYIGPMDLSVNLG
IPLQYSHPIFEEAITKVLKVCQKYDKTPGIHGLSLELVRKYIDMGFRFIAIMSDIGVMLS
GFRNILQQFNRSK
Download sequence
Identical sequences E0SR67
gi|305662808|ref|YP_003859096.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]