SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|305663118|ref|YP_003859406.1| from Ignisphaera aggregans DSM 17230

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|305663118|ref|YP_003859406.1|
Domain Number 1 Region: 111-301
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 0.0000000118
Family Hjc-like 0.086
Further Details:      
 
Domain Number 2 Region: 33-123
Classification Level Classification E-value
Superfamily PspA lactotransferrin-binding region 0.0000418
Family PspA lactotransferrin-binding region 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|305663118|ref|YP_003859406.1|
Sequence length 305
Comment hypothetical protein [Ignisphaera aggregans DSM 17230]
Sequence
MDIAELKARLLKLLEEDTEFRYAVAGLIGLGEILRRLDRHEEELKKIWEEIARLREDMNR
GFERYDQQIAKLWNEIAKLREDMVKGFERHDMELAKLREDMVKGFERHDIELAKLREDFN
RAIQLFEKRFEEIDRRFDEVNKRFEAIDKRFEIIVNRLDRHEEEIKRLREDMVKGFERID
RRISALGARWGIESEEAFREGLRGILEKELGFKVERWKARDDKGIVFGYPSEVEIDVAIV
DKKIILIEISSHVRASDVYTFKRKAELYKEKTGREPDRLIIVTPYADENALEAAAKLGIE
IYTRV
Download sequence
Identical sequences E0SSX6
gi|305663118|ref|YP_003859406.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]