SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|305663446|ref|YP_003859734.1| from Ignisphaera aggregans DSM 17230

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|305663446|ref|YP_003859734.1|
Domain Number 1 Region: 308-421
Classification Level Classification E-value
Superfamily Pseudouridine synthase 0.00000000122
Family Pseudouridine synthase II TruB 0.0053
Further Details:      
 
Domain Number 2 Region: 154-193
Classification Level Classification E-value
Superfamily THUMP domain-like 0.000068
Family Minimal THUMP 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|305663446|ref|YP_003859734.1|
Sequence length 430
Comment pseudouridylate synthase [Ignisphaera aggregans DSM 17230]
Sequence
MSIIDIANNILRKYCLCDRCLGRLFASLGRGLSNDERGKAIKIALVLELHKRYLDGDKDS
LKQLVELSPNIGPIAVNLIKNLGIEIEYTPRTCFICDNKINDIIDTYSQRIADIINERHI
NSFVLGIRGVTSYIRKEESIANEFKLLYWENIKRELKREIGKKIQMMTNAKVDFLNPEAM
IIIDIDRDRIYIESPSLLIYGRYWKLGRMISQNIWLTKNGVKKYPLSIEEIAKMLVKDGF
GDDVVLHIAGREDVDVRTLGSGRPFVLEIKRPRKRNIDIKDIENRLNSISRWLKFELNMF
VDRDFVSRVKKGCRTSYKIYRAIVVADRDIGIEDIKRLEEFFRDRIIEQRTPTRVLRRKK
DVLRRRKVFEIKTRVISPRVFEALIKCEGGLYVKELISGDNGRTVPSFSSVLNANTLCLT
LDALYVHEYI
Download sequence
Identical sequences E0SNQ8
gi|305663446|ref|YP_003859734.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]