SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|305663733|ref|YP_003860021.1| from Ignisphaera aggregans DSM 17230

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|305663733|ref|YP_003860021.1|
Domain Number - Region: 56-89
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0476
Family Classic zinc finger, C2H2 0.057
Further Details:      
 
Domain Number - Region: 3-24
Classification Level Classification E-value
Superfamily HIPIP (high potential iron protein) 0.0488
Family HIPIP (high potential iron protein) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|305663733|ref|YP_003860021.1|
Sequence length 101
Comment hypothetical protein [Ignisphaera aggregans DSM 17230]
Sequence
MDRRCRNCIFFRSYDFMDNFGYCIKNNVIVDPSNVSVCDNFREVSIDDLKEQIRVHGFVY
CATCRKFITSIDELEEHINKHLVTYGFIRDEVAPEEIPSAD
Download sequence
Identical sequences E0SQ10
gi|305663733|ref|YP_003860021.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]