SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|305663797|ref|YP_003860085.1| from Ignisphaera aggregans DSM 17230

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|305663797|ref|YP_003860085.1|
Domain Number 1 Region: 99-248
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 2.1e-22
Family Dihydroorotate dehydrogenase B, PyrK subunit 0.03
Further Details:      
 
Domain Number 2 Region: 4-92
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 0.00000000000216
Family Ferredoxin reductase FAD-binding domain-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|305663797|ref|YP_003860085.1|
Sequence length 259
Comment Dihydroorotate dehydrogenase, electron transfer subunit, iron-sulfur cluster binding domain [Ignisphaera aggregans DSM 17230]
Sequence
MSIKPARILYVDSIAKNIFLVRLKPIFSIGSPKPFQFFTVWIPRRDEIPLSIADFDGKEL
VFIYKVKGYGTKSFSELSKGSIVGLKGPLGRGIDVESLGRSILVIAGGIGIAPIPYLVRA
ITYNTNTKIDIFWGVKEYTEIFDIKSLISMERVNRIIISTEDCSQKNYLCGMITDVIDLR
EINNYDSIIAVGPLGMLKTVCRKFRDHNPYVALETIVKCGIGICGSCYIRYTDKLLCVDG
PVFRCSEVEKHLESEDTNT
Download sequence
Identical sequences E0SQE9
gi|305663797|ref|YP_003860085.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]