SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|305663907|ref|YP_003860195.1| from Ignisphaera aggregans DSM 17230

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|305663907|ref|YP_003860195.1|
Domain Number 1 Region: 6-265
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.37e-70
Family G proteins 0.00000423
Further Details:      
 
Domain Number 2 Region: 469-629
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.25e-52
Family Translational machinery components 0.0000254
Further Details:      
 
Domain Number 3 Region: 261-379
Classification Level Classification E-value
Superfamily Translation proteins 1.2e-28
Family Elongation factors 0.0015
Further Details:      
 
Domain Number 4 Region: 630-726
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 6.71e-22
Family EF-G/eEF-2 domains III and V 0.0038
Further Details:      
 
Domain Number 5 Region: 393-469
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.47e-21
Family EF-G/eEF-2 domains III and V 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|305663907|ref|YP_003860195.1|
Sequence length 738
Comment translation elongation factor 2 (EF-2/EF-G) [Ignisphaera aggregans DSM 17230]
Sequence
MRYVKTVDQILRIMNNIEQIRNVGIIAHVDHGKTTTTDSLLAAAGIISPRLAGQVLAMDF
LDVEQRRQMTVKAANISLYHEYEGKPYVINLVDTPGHVDFTGKVTRSLRMIDGAIVVVDA
VEGVMTQTETVLRQALEERVRPLLFINKIDRLIKELRLKPDEIKQRFIEIIKEVNNLIET
YADPEFKKKWILDPSQGMVAFGSAKDAIGITVPMSRKKGIKIDDIIEAYSSGDKEAIEEL
KKKIPLHEALLDMVVRFVPNPKEAQMYRIPKIWKGDISTDLGKALMEVDPDGPLVFFVCD
MRWDPHAGFVATGRIFSGTLYSGQEVYLVNSKAVQKVLQVGLYMGPYREVVDRIPAGNIA
AVLGPDLARSGETIVDLKIKDVIVPFERMRYISEPVVTMAIEPKKTTDLTKLMDALKKMS
IEDPNLIVKINEETGEYLVSGMGHLHLEIVLTLLKERFGLEVETSPPTVVYRETARDRSQ
IFEGKSPNKHNRLYISIEPMNEDTIRLIQQGIVTEDMDPHKRAKILRDEAGWDYDEARRI
WAIDENINVFIDKTSGIQYLREVRDTIIQGFRLAMREGPLAAEPVRGLKVILHDAVIHED
PAHRGPAQIYPAVRNPIFAAILTARPTLLEPIQKLEIKFPMDYLGPISSVITKRRGRILN
VVHMVGNLVKMLAEVPVAESIDLANELRGASAGKAFWGTEFSRWAPVPDSMLLDIVKKIR
QRKGLKPEPPRPEDFLSP
Download sequence
Identical sequences E0SQY5
gi|305663907|ref|YP_003860195.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]