SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|305663918|ref|YP_003860206.1| from Ignisphaera aggregans DSM 17230

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|305663918|ref|YP_003860206.1|
Domain Number - Region: 286-338
Classification Level Classification E-value
Superfamily PspA lactotransferrin-binding region 0.00445
Family PspA lactotransferrin-binding region 0.017
Further Details:      
 
Domain Number - Region: 392-439
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0418
Family Myosin rod fragments 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|305663918|ref|YP_003860206.1|
Sequence length 667
Comment hypothetical protein [Ignisphaera aggregans DSM 17230]
Sequence
MNSTSYEPTKKNSMSWIDIKVWLNEQKNNILRSYIDNVYYIEKALIMRIKNSIKNLDSWL
IIEPGKRINFLSTSIKPVSEEDPKTSLWRKNLKDCRIDDIEQYDNERIILIHLFCRNSRA
KTIVVELLPRGVIAILDESKRILLASEYKEMKDRSIKLGMEYMFPPSRTLYPLDRDLIDK
FIKNVSIGTIIKELGLPAEIVNSAAIECSITEKQLVDRVGIECLFSSINKWINTILNQPT
PCIVYKDNNAIGFYPFIPPFYNTPNYNVVITSSFNEAIERYFLQYTEELLTKRTINEMVK
EVEKLRKSIEDIDKKIVDFEKNLGDLKLRLQCYENHYTELEAIHKCVANIVKEIGWDYIR
KCGNIVQFQPSTGSYTVSINGCSINLNVRYSLIHQYNELRKNISDIEKSIERALEEKVKL
MQKINEMNNRILEEKQKVKVKLSLKKEWYEKYHWTITPTGFLVIGGRDASQNIQLIRRFL
EPNDIVLHADIHGASTVIIKTGGRDVDEETLMEAATIAACYSKAWKSGLLAIDVFWVYGS
QISLSPPTGEYLPKGSYMVYGKKNYIKNVSLKLALGIAIDENKNVKIVLGSENLVSRKSI
AYMVIVPGDETPEKIVNTFLEYVKKNINIESPSIIKDEIIKEIPGKSKVIKLVTRDSSNG
DTNAQSL
Download sequence
Identical sequences E0SQZ6
gi|305663918|ref|YP_003860206.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]