SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|326789601|ref|YP_004307422.1| from Clostridium lentocellum DSM 5427

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|326789601|ref|YP_004307422.1|
Domain Number 1 Region: 71-518
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 3.44e-151
Family Cellulases catalytic domain 0.00000000006
Further Details:      
 
Domain Number 2 Region: 535-685
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 1.36e-35
Family Cellulose-binding domain family III 0.0000104
Further Details:      
 
Domain Number 3 Region: 733-876
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 5.76e-29
Family Cellulose-binding domain family III 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|326789601|ref|YP_004307422.1|
Sequence length 877
Comment cellulase [Clostridium lentocellum DSM 5427]
Sequence
MKIKHRYFILGVGILCVLMIAIVIGSNINKKSTDVLVSEKETITEKYTMDKQGESKEEVG
KVNQHRPQTGNYNYGEALQKAILFYELQRSGDLTEQIRCNWRGDSGLSDGKDVGLDLTGG
WYDAGDHVKFNLPMAYTSTMLAWSVIEDEEVYKETNQYDYILSELRWVNDYLIKCHPKEE
VYYFQVGDGGADHAFWGAAEILQMERPSYKVDINNPGSAVCGEGAAALAASSMVFKKVDS
DYASTCLKTAKSLYALAEEMKGDSGYDAVAGAYYKSWSGYYDELAFAGAWLYLATGEEVY
LEKAKTYADLYAGGDINTANYTWAHSWDDVHYGAALLLARITGEELYKKAIENNLDYWTV
GVEGKKIQYTPKGLAWLDTWGSLRYATTTAFLASIYSEWEGCSKEKQQIYQAFALSQVEY
ALGSSGRSFMIGYGENYPKNPHHRTAHGGWENNVSGEPSQNRHILVGALVGGPNVNDEYK
DERSDYTANEVACDYNAGFTGLLAKMYKKYGGAPIENLTAIEEVGEELYIEAGINAEDSQ
NEKHYIEVKALVYNHTAWPARITDNLSFKYFLDLTDYIKAGGVPSDLITSYNNSSGKVMI
SKVLPWDESKHLYYVEVDLIGHTLYPGGQGEQRLEVQFRITGNSKWDYTQDYSYIDLKGT
SSNQLTQAQHFALYDKGILVFGSEPGQGTPLVNKPQTTEKANSNPVKENVNSSNNREEKL
QTDGGEVELKQTNASNSKSNTINLNLEIKGKKESQFDLKDLSIHYYYTSDTQDKQQFWCD
NAQIDMNKEPWYINLNSNISGKIMRMDQVKDGADHYLEIHFNNKDINLTGEGKITLGIRI
TNDQWKEYDQSNDYSYKNSDHIVIYYKGEVISGKEPK
Download sequence
Identical sequences F2JLD6
gi|326789601|ref|YP_004307422.1| WP_013655525.1.79355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]