SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|333993227|ref|YP_004525840.1| from Treponema azotonutricium ZAS-9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333993227|ref|YP_004525840.1|
Domain Number 1 Region: 402-513
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000196
Family Collagen-binding domain 0.011
Further Details:      
 
Domain Number 2 Region: 170-265
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000248
Family Collagen-binding domain 0.017
Further Details:      
 
Weak hits

Sequence:  gi|333993227|ref|YP_004525840.1|
Domain Number - Region: 281-390
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000301
Family Collagen-binding domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|333993227|ref|YP_004525840.1|
Sequence length 518
Comment pre-peptidase C family protein [Treponema azotonutricium ZAS-9]
Sequence
MKHIIPYIAMALLPLFCIALPLSAQSVSAGKEIASLDQLDLAAAELARSIRPELLKLPQN
SRIRVGAFYLDDSDTTLGSYLTQQLSAFLAGAPLNIVSPDTDFRTATAYTLRGSLLETGN
IIRIYARLVKTDDETLIHSWNTDLGVTDFIDTMIQISSSSNVRRDRYEPDSRENPIAVTL
GGSEIARTIHDSDDNDWFSITPDRQGVLVLETTGSMDTYMYLIDGDSSSELGSNDDGGQN
TNAKIEWFAEEGKTYIARVKGLDGSLGHYGFKTTLEAIPVDANEPNDTRERATLIASGSR
TEAVFGTAGDIDWYKVIIDPNSLPEGGQLSVWTEGRMDTTIAIYHRNEIIAEDDDSGDNE
NARLNITVSQGDYYIRASEARGRQGRYTLRTALRPVPVPDAYENDNSRSTAKDITIGDPV
QGRTFSDSNDIDWVRIVITGAGLYEIRTKANDSELDSFMELYNSDNDKIAEDDDSGDNYD
ARIRQRLEPGTYYLKISCLGDDPLEDNRYTLRVTRTGN
Download sequence
Identical sequences F5Y9G7
WP_015709955.1.50409 gi|333993227|ref|YP_004525840.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]