SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000004 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000004
Domain Number 1 Region: 91-219
Classification Level Classification E-value
Superfamily Cupredoxins 1.26e-55
Family Periplasmic domain of cytochrome c oxidase subunit II 0.00000355
Further Details:      
 
Domain Number 2 Region: 1-90
Classification Level Classification E-value
Superfamily Cytochrome c oxidase subunit II-like, transmembrane region 5.56e-28
Family Cytochrome c oxidase subunit II-like, transmembrane region 0.0000174
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000004   Gene: ENSPANG00000000019   Transcript: ENSPANT00000000019
Sequence length 227
Comment pep:known chromosome:PapAnu2.0:MT:7014:7697:1 gene:ENSPANG00000000019 transcript:ENSPANT00000000019 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHPVQLGLQDATSPVMEELITFHDQALMAMFLISFLILYALSSTLTTKLTNTNITDAQE
METIWTILPAVILILIALPSLRILYMTDEINNPSFTIKSIGHQWYWTYEYTDYGGLIFNS
YMLPPLFLNPGDLRLLEVDNRVVLPIEAPVRMMITSQDVLHSWTIPTLGLKTDAVPGRLN
QTVFTATRPGVYYGQCSEICGANHSFMPIVAELIPLKIFEMGPVFTL
Download sequence
Identical sequences C3UVJ7 C3UVK0 C3UVK5 C3UVK6 C3UZA5 P68297 P68298
ENSPANP00000000004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]