SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000016 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000016
Domain Number 1 Region: 473-551
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.89e-18
Family Cold shock DNA-binding domain-like 0.0024
Further Details:      
 
Domain Number 2 Region: 17-93
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.01e-17
Family Cold shock DNA-binding domain-like 0.0000157
Further Details:      
 
Domain Number 3 Region: 150-222
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.3e-16
Family Cold shock DNA-binding domain-like 0.0024
Further Details:      
 
Domain Number 4 Region: 630-710
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000228
Family Cold shock DNA-binding domain-like 0.0041
Further Details:      
 
Domain Number 5 Region: 305-386
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000552
Family Cold shock DNA-binding domain-like 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000000016
Domain Number - Region: 446-481
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0819
Family Cold shock DNA-binding domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000016   Gene: ENSPANG00000018873   Transcript: ENSPANT00000017495
Sequence length 767
Comment pep:known_by_projection chromosome:PapAnu2.0:1:115542208:115573589:-1 gene:ENSPANG00000018873 transcript:ENSPANT00000017495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFDPNLLHNNGHNGYPNGTSAALRETGVIEKLLTSYGFIQCSERQARLFFHCSQYNGNL
QDLKVGDDVEFEVSSDRRTGKPIAVKLVKIKQEILPEERMNGQEVFYLTYTPEDVEGNVQ
LETGDKINFVIDNNKHTGAVSARNIMLLKKKQARCQGVVCAMKEAFGFIERGDVVKEIFF
HYSEFKGDLETLQPGDDVEFTIKDRNGKEVATDVRLLPQGTVIFEDISIEHFEGTVTKVI
PKVPSKNQNDPLPGRIKVDFVIPKELPFGDKDTKSKVTLLEGDHVRFNISTDRRDKLERA
TNIEVLSNTFQFTNEAREMGVIAAMRDGFGFIKCVDRDVRMFFHFSEILDGNQLHIADEV
EFTVVPDMLSAQRNHAIRIKKLPKGTVSFHSHSDHRFLGTVEKEATFSNPKTTSPNKGKE
KEAEDGIIAYDDCGVKLTIAFQAKDVEGSTSPQIGDKVEFSISDKQRPGQQVATCVRLLG
RNSNSKRLLGYVATLKDNFGFIETANHDKEIFFHYSEFSGDVDSLELGDMVEYSLSKGKG
NKVSAEKVNKTHSVNGITEEADPTIYSGKVIRPLRSVDPTQTEYQGMIEIVEEGDMKGEV
YPFGIVGMANKGDCLQKGESVKFQLCVLGQNAQTMAYNITPLRRATVECVKDQFGFINYE
VGDSKKLFFHVKEVQDGIELQAGDEVEFSVILNQRTGKCSACNVWRVCEGPKAVAAPRPD
RLVNRLKNITLDDASAPRLMVLRQPRGPDNSMGFGAERKIRQAGVID
Download sequence
Identical sequences A0A024R0K2 A0A2I2ZK83 A0A2I3LWH7 A0A2J8JRY8 A0A2K5WDP9 F6VGP5
ENSP00000261443 ENSP00000342408 gi|338968934|ref|NP_001229822.1| gi|56117850|ref|NP_009089.4| ENSP00000261443 ENSP00000342408 ENSPANP00000000016 NP_001229822.1.87134 NP_001229822.1.92137 NP_009089.4.87134 NP_009089.4.92137 XP_002801763.1.72884 XP_003308346.1.37143 XP_003308348.1.37143 XP_003805684.1.60992 XP_003805687.1.60992 XP_004026442.1.27298 XP_005542302.1.63531 XP_007975662.1.81039 XP_010370263.1.97406 XP_011735279.1.29376 XP_011788500.1.43180 XP_011788501.1.43180 XP_011938664.1.92194 XP_011938665.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]