SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000052 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000052
Domain Number 1 Region: 165-314
Classification Level Classification E-value
Superfamily TPR-like 0.000000025
Family Tetratricopeptide repeat (TPR) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000052   Gene: ENSPANG00000010903   Transcript: ENSPANT00000025341
Sequence length 362
Comment pep:known_by_projection chromosome:PapAnu2.0:6:34268790:34309636:1 gene:ENSPANG00000010903 transcript:ENSPANT00000025341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQASPIRIPTVSNDIDWDFCFRMSQQTEIPAHQQTDKLYHTSGCGESEEETKAKEAEKAV
DCMSHPKEKLAQSQKKVAQLIREKSNNTQANKELIRCAILSRIIFGDHHWKCAQALTNLA
YGYLTLRGLPVQAKKHAVSAKNTLLTWKANTTSDKEREEILEALVMLYYTLGVAWLLQNQ
CREAYFNLQKAERNMKELKELYEGSVCELQVSEKDLTLALGRASLAIHRLNLALTYFEKA
IGDVIAAKGDRTSDLISLYEETAQIEQLRRNHNQAIQYLQQAHSICVSLFTEVSPKTAET
SALLAKAYAMSGEAQHRDAVETYFIKSINAYRATLGSEDFETLSTTEEFCKWLVQNGEKQ
VN
Download sequence
Identical sequences ENSPANP00000000052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]