SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000082 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000000082
Domain Number - Region: 228-250
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000288
Family CCCH zinc finger 0.0045
Further Details:      
 
Domain Number - Region: 132-153
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000563
Family CCCH zinc finger 0.0054
Further Details:      
 
Domain Number - Region: 339-379
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 0.0471
Family Delta-sleep-inducing peptide immunoreactive peptide 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000082   Gene: ENSPANG00000017947   Transcript: ENSPANT00000006147
Sequence length 526
Comment pep:known_by_projection chromosome:PapAnu2.0:11:51696181:51705064:1 gene:ENSPANG00000017947 transcript:ENSPANT00000006147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHAYFVHHRVWFRVWWLERHFFRRKRKSDRVGGSLSKLEDRQAAAATTAAAAEPSSDVE
VETHRSPGLHLSYLSGHQEWQDKENPELGGTRMPDRDSYANGTGSSGGGPGGGGSEEASG
AGTGSGGASSDAICRDFLRNVCKRGKRCRYRHPDMSEVSNLGVSKNEFIFCHDFQNKECS
RPNCRFIHGSKEDEDGYKKTGELPPRLRQKVAAGLGLSPADLPNGKEEVPICRDFLKGDC
QRGAKCKFRHLQRDFEFDARGGGGTGGGSTGSVLPGRRHDLYDIYDLPDRGFEDHEPGPK
RRRGGCCPPDGPHFESYEYSLAPPRGVECRLLEEENAMLRKRVEELKKQVSNLLATNEVL
LEQNAQFRNQAKVITLSSTAPATEQTLAPTVGTVATFNHGIAQTHTTLSSQALQPRPVSQ
QELVAPAGAPAAPPTNAAPPAAPPPPPPHLTPEITPLSAALAQTIAQGMAPPPVSMAPVA
VSVAPVAPVAVSMAQPLAGITMSHTTTPMVTYPIASQSMRITAMPH
Download sequence
Identical sequences ENSPANP00000000082 XP_001114150.2.72884 XP_015286502.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]