SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000088 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000000088
Domain Number - Region: 82-152
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0628
Family FCH domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000088   Gene: ENSPANG00000009531   Transcript: ENSPANT00000017094
Sequence length 158
Comment pep:known_by_projection chromosome:PapAnu2.0:2:71434011:71461457:1 gene:ENSPANG00000009531 transcript:ENSPANT00000017094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAVTDDSHSTVFPGARWMVLSSRRPTTPKARWKTTILTADEVIRKRLLIDGDGAGDDRR
INLLVKSFIKWCNSGSQEEGYSQYQRMLSTLSQCEFSMGKTLLVYDMNLREMENYEKIYK
EIECSIAGAHEKIAECKKQILQAKRIRKIAKNMMLWQK
Download sequence
Identical sequences ENSPANP00000000088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]