SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000100 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000100
Domain Number 1 Region: 271-382
Classification Level Classification E-value
Superfamily PX domain 3.14e-29
Family PX domain 0.001
Further Details:      
 
Domain Number 2 Region: 4-76
Classification Level Classification E-value
Superfamily SH3-domain 2.76e-16
Family SH3-domain 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000000100
Domain Number - Region: 73-144
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0759
Family beta-sandwich domain of Sec23/24 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000100   Gene: ENSPANG00000013387   Transcript: ENSPANT00000000640
Sequence length 601
Comment pep:novel chromosome:PapAnu2.0:6:50570390:50652910:1 gene:ENSPANG00000013387 transcript:ENSPANT00000000640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRARALYDFRSENPGEISLREHEVLSLCSEQDIEGWLEGVNSRGDRGLFPASYVQVIR
APEPSLAGDGGPSAPARYANVPPGGFEPLPAAPPASFKPPPDTFQPLLQPQQAPPPSTFQ
PPGAGFPYGGGALQPSPQQLYGGYQASQGSDDDWDDEWDDSSTVADEPGALGSGAYPDLD
GSSSAGVGAAGRYRLSTRSDLSLGSRSGSAPPQHHPSGAKSSATVSRNLNRFSTFVKSGG
EAFVLGEASGFVKDGDKLCVVLGPYGPEWQENPYPFQCTIDDPTKQTKFKGMKSYISYKL
VPTHTQVPVHRRYKHFDWLYARLAEKFPVISVPHLPEKQATGRFEEDFISKRRKGLIWWM
NHMASHPVLAQCDVFQHFLTCPSSTDEKAWKQGKRKAEKDEMVGANFFLTLSTPPAAALD
LQEVESKIDGFKCFTKKMDDSALQLNHTANEFARKQVTGFKKEYQKVGQSFRGLSQAFEL
DQQAFSVGLNQAIAFTGDAYDAIGELFAEQPRQDLDPVMDLLALYQGHLANFPDIIHVQK
GALTKVKESRRHVEEGKMEVQKADGIQDRCNTISFATLAEIHHFHQIRVSSSKHLPSFWS
S
Download sequence
Identical sequences A0A096MKS4
ENSPANP00000000100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]