SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000119 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000119
Domain Number 1 Region: 13-59
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.000000000314
Family MYND zinc finger 0.017
Further Details:      
 
Domain Number 2 Region: 79-192
Classification Level Classification E-value
Superfamily TPR-like 0.0000000114
Family Tetratricopeptide repeat (TPR) 0.053
Further Details:      
 
Domain Number 3 Region: 169-249
Classification Level Classification E-value
Superfamily TPR-like 0.00000733
Family Tetratricopeptide repeat (TPR) 0.013
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000000119
Domain Number - Region: 216-342
Classification Level Classification E-value
Superfamily TPR-like 0.00446
Family Tetratricopeptide repeat (TPR) 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000119   Gene: ENSPANG00000007738   Transcript: ENSPANT00000023909
Sequence length 365
Comment pep:known_by_projection chromosome:PapAnu2.0:1:44584086:44607514:-1 gene:ENSPANG00000007738 transcript:ENSPANT00000023909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVIYPLAVPKGRRLCCEVCEAPAERVCAACTVTYYCGVVHQKADWDSIHEKICQLLIPL
RTSMPFYNSEEERQHGLQQLQQRQKYLIEFCYTVAQKYLFEGKHEDAVPAALHSLRFRVN
LYGLSSVELVPAYLLLAEASLGLGRIVQAEEYLFQAQWTVLKSTDCSNATHSLLHRNLGL
LYIAKKNYEEARYHLANDIYFASCAFGTEDIRTSGGYFHLANIFYDLKKLDLADTLYTKV
SEIWHAYLNNHYQVLSQAHTQQVDLLGKLFENDTGLDEAQEAEAIRILTSILNIRESTSD
KAPQKTIFVLKILVMLYYLMMNSSKAQEYGMRALSLAKEQQLDVHEQSAIQELLSLISTE
DRRIT
Download sequence
Identical sequences A0A096MKU2 A0A2K5M2L8 A0A2K5ZBS9 F6SHK0 G7NUV8
ENSPANP00000000119 ENSMMUP00000001385 XP_001086575.1.72884 XP_005543797.1.63531 XP_011857123.1.47321 XP_011934594.1.92194 ENSMMUP00000001386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]