SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000147 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000147
Domain Number 1 Region: 5-86
Classification Level Classification E-value
Superfamily PDZ domain-like 4.07e-22
Family PDZ domain 0.00071
Further Details:      
 
Domain Number 2 Region: 280-309
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000252
Family LIM domain 0.0027
Further Details:      
 
Domain Number 3 Region: 248-279
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000233
Family LIM domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000147   Gene: ENSPANG00000011299   Transcript: ENSPANT00000006907
Sequence length 330
Comment pep:known_by_projection chromosome:PapAnu2.0:6:125839333:125854459:1 gene:ENSPANG00000011299 transcript:ENSPANT00000006907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHSVTLRGPSPWGFRLVGGRDFSAPLTISRVHAGSKAALAALCPGDLIQAINGESTELM
THLEAQNRIKGCHDHLTLSVSRPEGRSWPSAPDDSKAQAHRTHIDPEIQDGSPITSRRPS
GTGTGPEDGRPSLGSPYGQPPRFPVPHNGSSEATLPAQMSTLHVSPPPSADPARGFPRSR
DCRVDLGSEVYRMLREPAESVAAEPKQSGSFRYLQGMLEAGEGGERPGPGGPRNLKPTAS
KLGSPLSGLQGLPECTRCGHGIVGTIVKARDKLYHPECFMCSDCGLNLKQRGYFFLDERL
YCESHAKARVKPPEGYDVVAVYPNAKVELV
Download sequence
Identical sequences A0A096MKW1
ENSPANP00000000147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]