SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000149 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000149
Domain Number 1 Region: 278-449
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-42
Family SPRY domain 0.00019
Further Details:      
 
Domain Number 2 Region: 5-80
Classification Level Classification E-value
Superfamily RING/U-box 7.78e-20
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 3 Region: 86-148
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000366
Family B-box zinc-binding domain 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000000149
Domain Number - Region: 193-242
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0456
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000149   Gene: ENSPANG00000012470   Transcript: ENSPANT00000012741
Sequence length 451
Comment pep:novel chromosome:PapAnu2.0:14:79716692:79722679:1 gene:ENSPANG00000012470 transcript:ENSPANT00000012741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSGILQVFQRELTCPICMNYFIDPVTIDCGHSFCRPCFYLNWQDIPLLVQCSECRKSIR
QRNLETNIHLKKMASLARKASLWQFLSSEEQMCGTHRETKKMFCEVDRSLLCLLCSSSQK
HRDHKHCPIEWAAEEHREKLLKKMQSLWEEACENHRNLNMETTRTKYWKDYVNLRLEAVR
AEYQMPALHHEEEKHNLETLKKKGKDIFHQLHLSKAKMAHRREILRGMYEELKEMCHKPD
VELLQGFGDILHRSESVLLHKPQPLNLELSSGPIAGLMDRLNQFRVHITLHQEEANSHIF
RYEILRSMCIGCDHQDVPYITATPRSFLAWGAQTFTSGKYYWEFHVGDSWNWAFGVCNTY
WKEKNQNEKIDGEEGLFLLGCVKNDIQCRLFTTSPLMLQYISRPTSRVGLFLDYEAKTVS
FVDVNQSSLIYTIPNCSFSPPLRPVFCCIHF
Download sequence
Identical sequences ENSPANP00000000149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]