SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000174 from Papio anubis 76

(show help)
Strong hits

Sequence:	ENSPANP00000000174
Domain Number 1	Region: 122-151
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.00000000000386
Family	LIM domain	0.01
Further Details:

Domain Number 2	Region: 86-118
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.0000000002
Family	LIM domain	0.0034
Further Details:

Domain Number 3	Region: 58-86
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.00000000114
Family	LIM domain	0.0091
Further Details:

Weak hits

Sequence:	ENSPANP00000000174
Domain Number -	Region: 152-183
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.00665
Family	LIM domain	0.033
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

External link(s)	Protein: ENSPANP00000000174 Gene: ENSPANG00000004043 Transcript: ENSPANT00000005304
Sequence length	193
Comment	pep:known_by_projection chromosome:PapAnu2.0:14:56678911:56688978:1 gene:ENSPANG00000004043 transcript:ENSPANT00000005304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MPSGVARVWLQWLQAGEPQERAWSDLGLGEVDVLGWKTGLGGAHWGVPMLSVQPKGKQKG CAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFG TTGNCAACSKLIPAFEMVMRARDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQMDYE EGQLNGTFESQVQ
Download sequence
Identical sequences	ENSPANP00000000174 XP_011919125.1.92194

SEARCH