SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000299 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000299
Domain Number 1 Region: 67-325
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 8.24e-40
Family PhyH-like 0.074
Further Details:      
 
Domain Number 2 Region: 897-954
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 5.52e-22
Family Tudor domain 0.0000527
Further Details:      
 
Domain Number 3 Region: 955-1010
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.01e-16
Family Tudor domain 0.0000513
Further Details:      
 
Domain Number 4 Region: 731-767
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000244
Family PHD domain 0.02
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000000299
Domain Number - Region: 817-872
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00681
Family PHD domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000299   Gene: ENSPANG00000013120   Transcript: ENSPANT00000004156
Sequence length 1063
Comment pep:known_by_projection chromosome:PapAnu2.0:1:45942958:46000149:1 gene:ENSPANG00000013120 transcript:ENSPANT00000004156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYD
DIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERK
YWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGM
WKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRH
KMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYG
KQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLKESELP
PRAGNEEECPEEDMEGVEDGEEGDLKTSLAKHRIGTKRHRVCLEIPQEVSQSELFPKEEL
SSEQYEMTECPAALAPVRPTHSSVRQVEDGLTFPDYSDSTEVKFEELKNVKLEEEDEEEE
QEAAALDLSVNPASVGGRLVFSGSQKKSPSLGSGSSRDSISSDSETSEPLSCRAQGQTGV
LTVHSYAKGDGRVTVGEPCMRKKGSAARSISERELAEVADEYMFSLEENKKSKGRRQPLS
KLPRHHPLVLQECVSDDETSEQLTPEEEAEETEAWAKPLSQLWQNRPPNFEAEKEFNETM
AQQAPHCAVCMIFQTYHQVEFGGFTQNCGNASDLAPQKQRTKPLIPEMCFTSTGCSTDIN
LSTPYLEEDGTSILVSCKKCSVRVHASCYGVPPAKASEDWMCSRCSANALEEDCCLCSLR
GGALQRANDDRWVHVSCAVAILEARFVNIAERSPVDVSKIPLPRFKLKCIFCKKRRKRTA
GCCVQCSHGRCPTAFHVSCAQAAGVMMQPDDWPFVVFITCFRHKIPNLERAKGALQSITA
GQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQLGPPAEGE
VVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYTLDEELPKRVKSRLSVA
SDMRFNEIFTEKEVKQEKKRQRVINSRYREDYIEPALYRAIME
Download sequence
Identical sequences A0A096ML87
ENSPANP00000000299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]