SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000313 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000313
Domain Number 1 Region: 79-151
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.71e-21
Family Cold shock DNA-binding domain-like 0.00000907
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000313   Gene: ENSPANG00000010280   Transcript: ENSPANT00000004134
Sequence length 364
Comment pep:known_by_projection chromosome:PapAnu2.0:11:10380990:10403291:-1 gene:ENSPANG00000010280 transcript:ENSPANT00000004134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEAGELPQAPTEAAAAAPQDPAPKSPVGSGAPQAAAPAPAAHVAGNPGGDAAPAATGTA
AATSLATAAGSEDAEKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNP
RKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAADRRRYRRGYYGRRRGP
PRNYAGEEEEEGSGSSEGFDPPATDRQFSGARNQLRRPQYRPQYRQRRFPPYHVGQTFDR
RSRVLPHPNRIQAGEIGEMKDGVPEGTQLQGPVHRNPTYRPRYRSRGPPRPRPAPAVGEA
EDKENQQASSGPNQPSVRRGYRRPYNYRRRPRLPNAPSQDGKEAKAGEAPTENPAPPTQQ
SSAE
Download sequence
Identical sequences ENSPANP00000000313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]