SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000319 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000319
Domain Number 1 Region: 463-676
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.16e-32
Family Laminin G-like module 0.009
Further Details:      
 
Domain Number 2 Region: 688-889
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.9e-28
Family Laminin G-like module 0.014
Further Details:      
 
Domain Number 3 Region: 911-1113
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.1e-26
Family Laminin G-like module 0.0086
Further Details:      
 
Domain Number 4 Region: 148-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000322
Family EGF-type module 0.0032
Further Details:      
 
Domain Number 5 Region: 304-344
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000549
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 6 Region: 224-266
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000569
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 7 Region: 1297-1334
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000686
Family EGF-type module 0.0045
Further Details:      
 
Domain Number 8 Region: 186-229
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000001
Family EGF-type module 0.0034
Further Details:      
 
Domain Number 9 Region: 1141-1180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000322
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 10 Region: 262-300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000201
Family EGF-type module 0.0044
Further Details:      
 
Domain Number 11 Region: 1214-1252
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000201
Family EGF-type module 0.019
Further Details:      
 
Domain Number 12 Region: 72-114
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000025
Family EGF-type module 0.025
Further Details:      
 
Domain Number 13 Region: 111-152
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000437
Family EGF-type module 0.018
Further Details:      
 
Domain Number 14 Region: 1264-1302
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000579
Family EGF-type module 0.027
Further Details:      
 
Domain Number 15 Region: 1178-1219
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000594
Family EGF-type module 0.012
Further Details:      
 
Domain Number 16 Region: 377-481
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000879
Family Growth factor receptor domain 0.011
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000000319
Domain Number - Region: 924-959
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00737
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 885-915
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0154
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 27-58
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0522
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000319   Gene: ENSPANG00000006812   Transcript: ENSPANT00000009705
Sequence length 1335
Comment pep:known_by_projection chromosome:PapAnu2.0:1:166490702:166642642:-1 gene:ENSPANG00000006812 transcript:ENSPANT00000009705 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEILNTNIEIIAYIKFTILYFLADSFCNKNNTRCLSNSCQNNSTCKGFSKDNDCSCSGTA
NNVDKDCDDVKDPCFSNPCQGSATCVNTPGERSFLCKCPPGYSGTICETTIGSCGKNSCQ
HGGICHQDPIYPVCICPAGYAGRFCEIDHDECASSPCQNGAVCQDGIDGYSCFCVPGYQG
RHCDLEVDECASDPCKNEATCLNEIGRYTCICPRDYSGINCELEIDECWSQPCLNGATCQ
DALGAYFCDCAPGFLGDHCELNIDECASQPCLHGGLCVDGENRYSCNCTGSGFTGTHCET
LMPLCWSKPCHNNATCEDSVDNYTCHCWPGYTGAQCEIDINECNSNPCQSDGECVELSSE
KQYGHITGLPSTFSYHEASGYVCICQPGFTGIHCEEDVNECSSNPCQNGGTCENLPGNYT
CHCPFDNLSRTFYGGRDCSDILLGCTHQQCLNNGICIPHFQDGQHGFSCLCPSGYTGSLC
EIATTLSFEGDGFLWVKTGSATTKGSVCNIALRFQTVQPVALLLFRGNRDVFVKLELLSG
YIHLSIQVNNQPKVLLYISHNTSDGEWHFVEVIFAEAVTLTLIDDSCKEKCISKAPSPLE
SDPSICAFQNSFLGGLPVGTTSDGVALLNFYNIPSTPSFVGCLQDIKIDWNHITLENISS
GSSLNVKAGCVRKDWCESQPCQSRGRCINLWLSYQCDCHRPYKGPNCLREFVAGRFGQDD
STGYVVFTLDESYGDTVSLSMFVRTLQPSGLLLALENSTYQYIRVWLEHGRLTMLTPNSP
KLVVKFVLNDGNVHLISLKIKPNKIELYQSSQNLGFISASTWKIQKGDVIYIGGLPDKQE
TELNGGFFKGCIQDVRLNNQKLEFFPNSTNNVSLKPVLVNVTQGCPGDNSCKSNPCRNGG
VCHSLWDDFSCSCPAHTSGKACEEVQWCGFTPCPHEAQCQPVLQGFECIANAVFNGQSSQ
ILFRSNGNITRELTNITFGFRTRDANVIILHAEKEPEFLNISIQDSRLFFQLQSGNSFYM
LSLTSLQSVNDGMWHEVTLSMTDPMSQTSRWQMEVDNQTPFVTSTIATGSLNFLKDNTDI
YVGDGAIDNIKGLQGCLSTIEIGGIYLSYFENVHGFTNRPQEEQFLKISTNSVVTGCLQL
SVCNSNPCLHGGNCEDIYSSYHCSCPLGWSGKHCELNTDECFSNPCIHGNCSDRVAAYHC
TCEPGYTGGNCEVDIDNCQSHQCANGATCISDTNGYSCLCFGNFTGKFCRQSTLPSTVCG
NEETNLTCYNGGNCTEFQAELKCMCRPGFTGERCEKDIDECASDPCVNGGLCQDLLNKFQ
CLCDVAFAGERCEVD
Download sequence
Identical sequences ENSPANP00000000319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]