SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000337 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000337
Domain Number 1 Region: 50-188
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 8.24e-38
Family Regulator of G-protein signaling, RGS 0.0000935
Further Details:      
 
Domain Number 2 Region: 356-458
Classification Level Classification E-value
Superfamily Ubiquitin-like 2e-33
Family Ras-binding domain, RBD 0.000043
Further Details:      
 
Domain Number 3 Region: 301-369
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.82e-20
Family Ras-binding domain, RBD 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000337   Gene: ENSPANG00000011467   Transcript: ENSPANT00000010133
Sequence length 564
Comment pep:known_by_projection chromosome:PapAnu2.0:6:170725904:170740555:1 gene:ENSPANG00000011467 transcript:ENSPANT00000010133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGKPKHLGVPNGRMVLAVSDGELSSTTGPQGQGEGRGSSLSIHSLPSGPSSPFPTEEQP
VASWALSFERLLQDPLGLAYFTEFLKKEFSAENVTFWKACERFQQIPASDTQQLAQEARN
IYQEFLSSQALSPVNIDRQAWLGEEVLAEPRPDMFRAQQLQIFNLMKFDSYARFVKSPLY
RECLLAEAEGRPLREPGSSRLGSPDATRKKPKLKPGKSLPLGVEELGQPPVEGPGSRPLR
KSFRRELGGTANAALRRESQGSLNSSASLDLGFLAFVSSKSESHRKSLGSTEGESESRPG
KYCCVYLPDGTASLALARPGLTIRDMLAGICEKRGLSLPDIKVYLVGNEQALVLDQDCTV
LADQEVRLENRITFELELTALDRVVRISAKPTKRLQEALQPILEKHGLSPLQVVLHRPGE
KEPLDLGKLVSSVAAQRLVLDTLPGVKISKARDKSPCRSQGCPPRTQDKATHPPPASPSS
LVKAPSSATGKRQTCDIEGLVELLNRVQSSGAHDQRGLLRKRLILSRFSAAAYSRGPAPG
RTHPQTESAAQPGGSLNSTTDSAL
Download sequence
Identical sequences ENSPANP00000000337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]