SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000348 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000348
Domain Number 1 Region: 152-268
Classification Level Classification E-value
Superfamily TPR-like 0.000000000209
Family Tetratricopeptide repeat (TPR) 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000348   Gene: ENSPANG00000002532   Transcript: ENSPANT00000020537
Sequence length 308
Comment pep:known_by_projection chromosome:PapAnu2.0:19:17450116:17474248:-1 gene:ENSPANG00000002532 transcript:ENSPANT00000020537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPAPGPASGGSGEVDELFDVKNAFYIGSYQQCINEAQRVKLSSPERDVERDVFLYRAY
LAQRKFGVVLDEIKPSSAPELQAVRMFADYLAHESRRDTIVAELDREMSRSVDVTNTTFL
LMAASVYLHDQNPDAALRALHQGDSLECMAMTVQILLKLDRLDLARKELKRMQDLDEDAT
LTQLATAWVSLATGGEKLQDAYYIFQEMADKCSPTLLLLNGQAACHMAQGRWEAAEGLLQ
EALDKDSGYPETLVNLIVLSQHLGKPPEVTNRYLSQLKDAHRSHPFIKEYQAKENDFDRL
VLQYAPSA
Download sequence
Identical sequences A0A0A0MTZ5
ENSPANP00000000348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]