SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000354 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000354
Domain Number 1 Region: 95-212
Classification Level Classification E-value
Superfamily PX domain 6.28e-32
Family PX domain 0.00046
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000000354
Domain Number - Region: 247-435
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000408
Family BAR domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000354   Gene: ENSPANG00000013360   Transcript: ENSPANT00000012684
Sequence length 451
Comment pep:known_by_projection chromosome:PapAnu2.0:1:99739322:99846403:1 gene:ENSPANG00000013360 transcript:ENSPANT00000012684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGERRASQARSSGLPAGGADGESPGGSAPFPGSSGSSALLQAEVLDLDEDEDDLEVFSK
DASLMDMNSFSPMMPTSPLSMINQIKFEDEPDLKDLFITVDEPESHVTTIETFITYRIIT
KTSRGEFDSSEFEVRRRYQDFLWLKGKLEEAHPTLIIPPLPEKFIVKGMVERFNDDFIET
RRKALHKFLNRIADHPTLTFNEDFKIFLTAQAWELSSHKKQGPGLLSRMGQTVRAVASSM
RGVKNRPEEFMEMNNFIELFSQKINLIDKISQRIYKEEREYFDEMKEYGPIHILWSASEE
DLVDTLKDVAGCIDRCCKATEKRMSGLSEALLPVVHEYVLYSEMLMGVMKRRDQIQAELD
SKVEALTYKKTDTDLLPEEIGKLEDKVECANNALKADWERWKQNMQNDIKLAFTDMAEEN
IHYYEQCLATWESFLTSQTNLHLEETSEDKP
Download sequence
Identical sequences A0A096MLD8 A0A2K5ULP1 A0A2K6BPM5 I0FSD9
ENSPANP00000000354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]