SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000366 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000366
Domain Number 1 Region: 439-588
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000184
Family Calmodulin-like 0.065
Further Details:      
 
Domain Number 2 Region: 274-360,551-588
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000214
Family Calmodulin-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000366   Gene: ENSPANG00000023884   Transcript: ENSPANT00000028180
Sequence length 618
Comment pep:known_by_projection chromosome:PapAnu2.0:8:14942527:15029860:1 gene:ENSPANG00000023884 transcript:ENSPANT00000028180 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAWLGWGFGAGEQSRDPPPLLGSSRAEPGVPCADGGVAGPRGRASIRVAPGRPRSSRTD
FSRGFGAPLHPRPSVLRPLPALKWAVTAMAALRRLLWPPPRLPPPLCAHQPLLGPWGRPA
GAAPGLPGRPFSSREDEERAVAEAAWRRRRRWGELSVAAAAGGGLVGLVCYQLYGDPRAG
STATGRPSESAVAEPEDPPRGRGMLPIPVAAAKETVAIGRTDIEDLDLCATSRERRFRLF
ASIECEGQLFMTPYDFILAVTTDEPKVAKTWKSLSKQELNQMLAETPPVWKGSSKLFRNL
KERGVISYTEYLFLLCILTKPHAGFRIAFNMFDTDGNEMVDKKEFLVLQEIFRKKNEKRE
TKGDEEKRAMLRLQLYGYHSPTNSVLKTDAEELVSRSYWDTLRRNTSQALFSDLAERADD
ITSLVTDTTLLVHFFGKKGKAELNFEDFYRFMDNLQTEVLEIEFLSYSNGMNTISEEDFA
HILLRYTNVENTSVFLENVRYSIPEEKGITFDEFRSFFQFLNNLEDFAIALNMYNFASRS
IGQDEFKRAVYVATGLKLSPHLVNTVFKIFDVDKDDQLSYKEFIGIMKDRLHRGFRGYKT
VQKYPTFKSCLKKELHSR
Download sequence
Identical sequences A0A096MLF0
ENSPANP00000000366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]