SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000369 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000369
Domain Number 1 Region: 900-1012
Classification Level Classification E-value
Superfamily SEA domain 4.84e-18
Family SEA domain 0.0086
Further Details:      
 
Domain Number 2 Region: 244-339
Classification Level Classification E-value
Superfamily SEA domain 0.0000000000051
Family SEA domain 0.0052
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000000369
Domain Number - Region: 1060-1102
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0241
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000369   Gene: ENSPANG00000017183   Transcript: ENSPANT00000000580
Sequence length 1244
Comment pep:known_by_projection chromosome:PapAnu2.0:2:21142515:21242683:-1 gene:ENSPANG00000017183 transcript:ENSPANT00000000580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIMFPLFGKISLGILIFVLIGDFPSLTAQTYLSLEEIQEPKSAVSFLLPEESTDLSLATK
KKQPLDLRETERQWLLRRRRSILFPNGVKICPDESVTEAVANHVKYFKVRVCQEAVWEAF
RTFWDRLPGHEEYHYWMNLCEDGVTSIFEMGTNFSESVEHRSLIMKKLTYAKETVSSPEL
SSPVPVGDTSTLGDAALSVPHPGVDSYEGASDSSLERPEESISNEIENVIEEATKPAAEQ
IAEFSIHLLGKEYREELQDSSSFHHQHLEEEFISEVENAFTGLPGYKEIRVLEFRSPKEN
DSHSGVDVYYAVTFNGEAISNTTWDLISLHSNKVENHGLVELDDKPTVVYTISNFRDYIA
ETLQQNFLLGNSSLNPDPDSLQLINVRGVLRHQTEDLVWNTQSSSLQATPSSILDNTFQA
AWPSADESTTSSIPPLDFSSGPPSATGRELWSESPLGDLVSTHKLAFPSKMGLSSSPEVL
EVSSLTLHSVTPAVLQTGLPVASEERTSGSHLVEDGLANVEESEDFLSIDSLPSSSFTQP
VPKETIPSMEDSDVSLTSSPYLTSSIPFGLDSLTSKVKDQLKVSPFLPDASMEKELILDS
GLGSGSGQKVDLITWPWSETSSEKSTEPLSKPWLEDDDSLLPAEIEDKKLVLVDKMDSTD
QISKHSKYEHDDRSTHFPEEEPLSGPAVPFFADTATESASLTLPKHISEVPGVDDYSVTK
APLILTSVAISASTEISDQADAILREDMEQTTESSNYEWFDSEVSMVKPDMQPLWTILPE
SERVSTRTSSLEKLSRDTLASTPQSTDRLWLKASVTQSTKLPPSTIPTLLEDEVIMGVQD
ISLELDRIGTDYYQPELVQEQNGKVGSYVEMSTSVHSTEMVSVAWPTEGGDDLSYTQTSG
ALVVFFSLRVTNMMFSEDLFNKNSLEYKALEQRFLELLVPYLQSNLTGFQNLEILNFRNG
SIVVNSRMKFANSVPPNVNNAVYMILEDFCTAAYNTMNLAIDKYSLDVESGDEANPCKFQ
ACNEFSECLVNPWSGEAKCRCFPGYLSVEERPCQSLCDLQPDFCLNDGKCDIMPGHGAIC
RCRVGENWWYRGKHCEEFVSEPVIIGITIASVVGLLVIFSAIIYFFIRTLQAHHDRSERE
RPFSGFSRQPDSLSSIENAVKYNPVYKSHRAGCEKYEGPYPQHPFYSSASGDMIGGLSRE
EIRQMYESSELSREEIQERMRVLELYANDPEFAAFVKEQQISPV
Download sequence
Identical sequences ENSPANP00000000369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]