SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000373 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000373
Domain Number 1 Region: 103-238
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 8.73e-31
Family Glutathione S-transferase (GST), C-terminal domain 0.000000227
Further Details:      
 
Domain Number 2 Region: 11-102
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.28e-25
Family Glutathione S-transferase (GST), N-terminal domain 0.00000897
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000373   Gene: ENSPANG00000017112   Transcript: ENSPANT00000026074
Sequence length 241
Comment pep:novel chromosome:PapAnu2.0:X:69565153:69565878:1 gene:ENSPANG00000017112 transcript:ENSPANT00000026074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGESARSLGKGNAPPGPVPEGSIRVYSVRFCPFAERTRLVLKAKGIRHELISINLKNKP
EWFFKKNPFGLVPVLENSQDQLICESPITCEYLDEAYPGKKLLPDDSYEKACQKMILELF
SKVPSLVRSFIRSQNKEDYAGLKEEFRKEFTELEEVLSNKQTMFFGDNSLSMIDYLIWPW
FERLEAMKLYECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNCPEACDYG
L
Download sequence
Identical sequences ENSPANP00000000373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]