SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000374 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000374
Domain Number 1 Region: 7-197
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.68e-74
Family Glutathione peroxidase-like 0.00000000653
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000374   Gene: ENSPANG00000011805   Transcript: ENSPANT00000022725
Sequence length 198
Comment pep:novel chromosome:PapAnu2.0:X:38611256:38611852:-1 gene:ENSPANG00000011805 transcript:ENSPANT00000022725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSN
RAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKT
DEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGS
DTIKPNVDDSKEYFSKHN
Download sequence
Identical sequences A0A096MLF8
ENSPANP00000000374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]