SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000412 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000412
Domain Number 1 Region: 124-166
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.28e-16
Family LIM domain 0.0024
Further Details:      
 
Domain Number 2 Region: 167-201
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000343
Family LIM domain 0.0012
Further Details:      
 
Domain Number 3 Region: 8-35
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000384
Family LIM domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000412   Gene: ENSPANG00000023047   Transcript: ENSPANT00000000643
Sequence length 201
Comment pep:known_by_projection chromosome:PapAnu2.0:11:72258963:72267026:-1 gene:ENSPANG00000023047 transcript:ENSPANT00000000643 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTVXTLNMDRGERL
GIKPESIPSCIKESCSQKQVIYIYFYFAAPWRPDVMKLNGREMCCVNHERRFSCAVVQPH
RPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKIIGAGKPWHKNCFRCAKCGKSLESTTL
TEKEGEIYCKGCYAKNFGPKG
Download sequence
Identical sequences ENSPANP00000000412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]