SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000433 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000433
Domain Number 1 Region: 153-294
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.91e-27
Family UBX domain 0.01
Further Details:      
 
Domain Number 2 Region: 6-54
Classification Level Classification E-value
Superfamily UBA-like 7.98e-17
Family UBA domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000433   Gene: ENSPANG00000005453   Transcript: ENSPANT00000004440
Sequence length 297
Comment pep:known_by_projection chromosome:PapAnu2.0:14:11055452:11058579:1 gene:ENSPANG00000005453 transcript:ENSPANT00000004440 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELTALESLIEMGFPRGRAEKALALTGNQGIEAAMDWLMEHEDDPDVDEPLETPLGHIL
GREPTSSEQGGLEGSGSAAGEGKPILSEEERQEQTKRMLELVAQKQREREEREEREALER
ERQRRRQGQELSAARQRLQEDEMRRAAEERRREKAEELAARQRVREKIERDKAERAKKYG
GSVGSQPPPPAPEPGPVPSSPSQEPPTKREYDQCRIQVRLPDGTSLTQTFRAREQLAAVR
LYVELHRGEEPGGGQDPVQLLSGFPRRAFSEADMERPLQELGLVPSAVLIVAKKCPS
Download sequence
Identical sequences A0A0D9R2V7 A0A2I3LXZ4 A0A2K5MN15 A0A2K5VTT1 A0A2K5XUW0 A0A2K6B186
ENSPANP00000000433 XP_005577631.1.63531 XP_007993567.1.81039 XP_011718767.1.29376 XP_011848776.1.47321 XP_011897441.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]