SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000470 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000470
Domain Number 1 Region: 1864-2073
Classification Level Classification E-value
Superfamily SET domain 1.2e-71
Family Histone lysine methyltransferases 0.00071
Further Details:      
 
Domain Number 2 Region: 1747-1877
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.53e-27
Family PWWP domain 0.0000229
Further Details:      
 
Domain Number 3 Region: 317-411
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.26e-19
Family PWWP domain 0.01
Further Details:      
 
Domain Number 4 Region: 1696-1765
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000354
Family PHD domain 0.003
Further Details:      
 
Domain Number 5 Region: 1531-1588
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000687
Family PHD domain 0.008
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000000470
Domain Number - Region: 1592-1645
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0173
Family PHD domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000470   Gene: ENSPANG00000016763   Transcript: ENSPANT00000003649
Sequence length 2698
Comment pep:known_by_projection chromosome:PapAnu2.0:6:170494819:170661762:1 gene:ENSPANG00000016763 transcript:ENSPANT00000003649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQTCELPRRNCLLPFSNPVNLDAPEDKDSPFGNGQSNFSEPLNGCTMQLSTVSGTSQNA
YGQDSPSCYIPLRRLQDLASMINVEYLNGSADGSESFQDPEKSDSRAQTPIVCTSLSPGG
PTALAMKQELSCNNSPELQVKVTKTIKNGFLHFENFTCVDDADVDSEMDPEQPVTEDESI
EEIFEETQTNATCNYETKSENGVKVAMGSEQDSTPESRHGAVKSPFLPLAPQTETQKNKQ
RNEVDGSNEKAALLPAPFSLGDTNITIEEQLNSINLSFQDDPDSSTSTLGNMLELPGTSS
SSTSQELPFCQAKKKSTPLKYEVGDLIWAKFKRRPWWPCRICSDPLINTHSKMKVSNRRP
YRQYYVEAFGDPSERAWVAGKAIVMFEGRHQFEELPVLRRRGKQKEKGYRHKVPQKILSK
WEASVGLAEQYDVPKGSKNRKCIPGSIKLDSEEDMLFEDCTNDPESEHDLLLNGCLKSLA
FDSEHSADEKEKPCAKSRARKSSDNPKRTSVKKGHIQFEAHKDERRGKIPENLGLNFISG
DISDTQASNELSRIANSLTGSNTAPGSFLFSSCGKNTAKKEFETSNGDALLGLPEGALIS
KCSREKNKPQRSLVCGSKVKLCYIGAGDEEKRSDSISICTTSDDGSSDLDPIEHSSESDN
SVLEITDAFDRTENMLSMQKNEKIKYSRFAATNTRVKAKQKPLISNSHTDHLMGCTKSAE
PGTETSQVNLSDLKASTLVHKPRSDFTSDDLSPKFNMSSSISSENSLIKGGAVNQALLHS
KSKQPKFRSIKCKHKENPVMVEPPVTNDEYSLKCCSSDTKGSPLASISKSGKVDGLKLLN
NMHEKTRDSSDIETAVVKHVLSELKELSYRSLGEDVSDSGTSKPSKPLLFSSPSQNHIPI
EPDYKFSTLLMMLKDMHDSKTKEQRLMTAQNLVSYRSPGRGDCSTNSPVGVSKVLVSGGS
THNSEKKGDGTQNSANLSPSGGDSALSGELSASLPGLVSDKRDLPASGKSRSNCVTRRNC
GRSKPSSKLRDAFSAQVVKNTVNRKALKTERKRKLNQLSSVTLDAALQGDREHGGSLRGG
AEDPSKEEPLQIMGHLPSEDGDHFSDVHFDNKVKQSDPGKISEKGPSFENGKGPELDSVM
NSENDELNGVNQVVPKKRWQRLNQRRTKPRKRMNRFKEKENSECAFGALLPSDPVQEGRD
EFPEHRTSSASILEEPLTDQKHADCLDSVGPRLNVCDKSSASIGDMEKEPGIPSLTPQAE
LPEPAVRSEKKRLRKPSKWLLEYTEEYDQIFAPKKKQKKVQEQVHKVSSRCEEESLLARG
RSSAQNKQVDENSLISTKEEPPVLEREAPFLEGPLAQSELGGGHAELPQLTLSVPVAPEV
SPRPALESEELLVKTPGNYESKRQRKPTKKLLESNDLDPGFMPKKGDLGLSKKCYEAGHL
ENGITESCATSYSKDFGGVIGTSKIFDRPRKRKRQRHAAAKMQCKKVKNDDSSKEIPSLE
GELMPHRTAASPKETVEEGVEHDSGMPASKKMQGERGGGAALKENVCQNCEKLGELLLCE
AQCCGAFHLECLGLTEMPRGKFICNECRTGIHTCFVCKQSGEDVKRCLLPLCGKFYHEEC
VQKYPPTVMQNKGFRCSLHICITCHAANPANVSASKGRLMRCVRCPVAYHANDFCLAAGS
KILASNSIICPNHFTPRRGCRNHEHVNVSWCFVCSEGGSLLCCDSCPAAFHRECLNIDIP
EGNWYCNDCKAGKKPHYREIVWVKVGRYRWWPAEICHPRAVPSNIDKMRHDVGEFPVLFF
GSNDYLWTHQARVFPYMEGDVSSKDKMGKGVDGTYKKALQEAAARFEELKAQKELRQLQE
DRKNDKKPPPYKHIKVNRPIGRVQIFTADLSEIPRCNCKATDENPCGIDSECINRMLLYE
CHPTVCPAGGRCQNQCFSKRQYPEVEIFRTLQRGWGLRTKTDIKKGEFVNEYVGELIDEE
ECRARIRYAQEHDITNFYMLTLDKDRIIDAGPKGNYARFMNHCCQPNCETQKWSVNGDTR
VGLFALSDIKAGTELTFNYNLECLGNGKTVCKCGAPNCSGFLGVRPKNQPIATEEKSKKK
KLEFWGKRWLVSGISSLNQGQCEGRSSSTCSDCSIAMAHVIYISFFLNFCFTSVFSGKWE
CPWHQCDICGKEAASFCEMCPSSFCKQHREGMLFISKLDGRLSCTEHDPCGPNPLEPGEI
REYVPPPVPLPPGPSTHLAEQSTGMAAQAPKMSDKPPADTNQTLSLSKKALAGTCQRPLL
PERPLERTDSRSQPLDKVRDLAGSGTKSQSLVSSQRPLDRQPAVAGPRPQLSDKPSPVTS
PSSSPSVRSQPLERPLGTADPRLDKSIGAASPRPQSLEKTPVPTGLRLPPPDRLLITSSP
KPQTSDRPPDKPHASLSQRLPPPEKVLSAVVQTLVAKEKALRPVDQNTQSKNRAALVMDL
IDLTPRQKERAASPHEVTPQADEKMPVLESSSWPASKGLGHMPRAVEKGSVSDPLQTSGK
VAAHSEDPWQAVKSFTQARLLSQPPAKAFLYEPTTQASGRAPAGTEQTPGPLSQVPGLVK
QAKQMVGGQQLPALAARSGQSFRSLGKAPASLPTEEKKLVTTEQSPWALGKASSRAGLWP
IVAGQTLAQSCWSPGSTQTLAQTCWSLGRGQDPKPEQNTLPALNQAPSTHKCAESEQK
Download sequence
Identical sequences ENSPANP00000000470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]