SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000484 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000484
Domain Number 1 Region: 42-420
Classification Level Classification E-value
Superfamily SAICAR synthase-like 6.54e-121
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.000000000179
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000484   Gene: ENSPANG00000004831   Transcript: ENSPANT00000023691
Sequence length 421
Comment pep:novel chromosome:PapAnu2.0:3:104784833:104786725:-1 gene:ENSPANG00000004831 transcript:ENSPANT00000023691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSSVPPATVPAATAGPGPGFGFASKTKKKHFVQQKVKVFRAADPLMGVFLWGVAHSIN
ELSQVPLPVMLLPDDFKASSKIKVNNHLFHRKNLPSHFKFKEYCPQVFRNLRDRFGIDDQ
DYLVSLTRNPPSESEGSGGRFLISYDRTLVIKEVSSEDIADMHSNLSNYHQYIVKCHGNT
LLPQFLGMYRVSVDNEDSYMLVMHNMFSHRLPVHRKYDLKGSLVSREASDKEKVKELPTL
KDMDFLNKNQKVYIGEEEKKIFLEKLKRDVEFLVQLKIMDYSLLLGIHDIIRGSEPEEEG
PVREDESEVDGDCSLTGPPALVGSYGTSPEGIGGYIQSHRPLGPGEFESFIDVYAIRSAE
GAPQKEVYFMGLIDILTQYDAKKKAAHAAKTVKHGAGAEISTVHPEQYTKRFLDFITNIF
A
Download sequence
Identical sequences ENSPANP00000000484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]