SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000492 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000492
Domain Number 1 Region: 915-1090
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.84e-37
Family BCR-homology GTPase activation domain (BH-domain) 0.00054
Further Details:      
 
Domain Number 2 Region: 490-606
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.31e-32
Family Pyk2-associated protein beta ARF-GAP domain 0.0018
Further Details:      
 
Domain Number 3 Region: 284-380
Classification Level Classification E-value
Superfamily PH domain-like 9.04e-25
Family Pleckstrin-homology domain (PH domain) 0.00045
Further Details:      
 
Domain Number 4 Region: 1176-1323
Classification Level Classification E-value
Superfamily PH domain-like 3.41e-18
Family Pleckstrin-homology domain (PH domain) 0.042
Further Details:      
 
Domain Number 5 Region: 8-64
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000373
Family SAM (sterile alpha motif) domain 0.0042
Further Details:      
 
Domain Number 6 Region: 604-785
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000016
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Domain Number 7 Region: 391-498
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000193
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 
Domain Number 8 Region: 800-908
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000767
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 
Domain Number 9 Region: 1133-1196
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000475
Family Ras-binding domain, RBD 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000492   Gene: ENSPANG00000024671   Transcript: ENSPANT00000025729
Sequence length 1546
Comment pep:known_by_projection chromosome:PapAnu2.0:6:135149119:135175320:-1 gene:ENSPANG00000024671 transcript:ENSPANT00000025729 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPQDLDISVWLATVHLEQYADTFRRHGLATAGAARGLGHEELKQLGISATGHRKRILR
LLQTGTEEGSLDPKSDSAMEPSSSPAPQIQPPKPVPKPRTVFGGLSGPATTQRPGLSPIL
GEPGVSRSPEPSPRPPPLPTSSTEQSSALNTVEMMPNSIYFGLDLRGRAQAAQEKAPDSS
QTTAPTPALRPTAGTVHIMDPGCLYYGVQPVGTPGAPDRREGRGVCQDRAEHRLSRQDLE
AREDAGYASLELPGDSTLSSPTLETEETSDDLISPYASFSFTADRPTPLLSGWLDKLSPQ
GNYVFQRRFVQFNGRSLMYFGSDKDPFPKGVIPLTAIEMTRSSKDNKFQVITGQRVFVFR
TESEAQRDTWCSTLQSCLKEQRLLGHPRPPQPPRPLRTGMLELRGHKAKVFAALSPGELA
LYKSEQAFSLGIGICFIELQGCSVRETKSRSFDLLTPHRCFSFTAESGGARQSWAAALQE
AVTETLSDYEVAEKIWSNRANRHCADCGSSRPDWAAVNLGVVICKQCAGQHRALGSGISK
VQSLKLDTSVWSNEIVQLFIVLGNDRANRFWAGTLPPGEGLHPDATPGLRGEFISRKYRL
GLFRKPHPQYPDHSQLLQALCAAVAGPNLLKNMTQLLCVEAFEGEEPWSPPALDGSCPGL
VPPDPSPGVYNEVVVPATYSGFLYCGPVTNKAGPSPPRRGRDAPPRLWCVLGAALEMFAS
ENSPEPLSLIQPQDIVCLGVSPPPTDPGDLDRFPFSFELILTGGRIQHFGTDGADSLEAW
TSAVGKWFSPLSCHQLLGPGLLRLGRLWLRSPSHTAPAPGVWLSGFGLLRGDHLFLCSAP
GPGPPAPEDMVHLRRLQEISVVSAADTPDKKEYLVLVETGRTLYLQGEGRLDFTAWNTAI
GGAAGGGGTGLQEQQMSRGDIPIIVDACISFVTQHGLRLEGVYRKGGARARSLKLLAEFR
RDARSVKLRPGEHFVEDVTDTLKRFFRELDDPVTSARLLPRWREAAELPQKNQRLQKYKD
VIGCLPRVNRRTLATLIGHLYRVQKCAALNQMCTRNLALLFAPSVFQTDGRGEHEVRVLQ
ELIDGYISVFDIDSDQVAQIDLEVSLITTWKDVQLSQAGDLIMEVYIEQQLPDNCVTLKV
SPTLTAEELTNQVLEMRGTAAGMDLWVTFEIREHGELERPLHPKEKVLEQALQWCQLPEP
CSASLLLKKVPLAQAGCLFTGIRRESPRVGLLRCREEPPRLLGSRFQERFFLLRGRCLLL
LKEKKSSKPEREWPLEGAKVFLGIRKKLKPPTPWGFTLILEKMHLYLSCTDEDEMWDWTT
SILKAQHDDQQPVVLRRRSSSDLARQKFGTMPLLPIRGDDSGATLLSANQTLRQLHNRRT
LSMFFPMKSSQGSVEEQEELEEPVYEEPVYEEVGAFPELTQDTSTSFSTTREWTVKPENP
LTSQKSLDQPFLSKSSTLGQEERLPEPPPGPLSKSSPQARGSLEEQLLQELSSLILRKGE
TTAGLGSPSQPSSPQSPSPTGLPTQTPGFPTQPPCTSSPPSSHPLT
Download sequence
Identical sequences A0A096MLR3
ENSPANP00000000492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]