SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000556 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000556
Domain Number 1 Region: 9-44
Classification Level Classification E-value
Superfamily SAP domain 0.0000000714
Family SAP domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000556   Gene: ENSPANG00000013149   Transcript: ENSPANT00000028591
Sequence length 208
Comment pep:known_by_projection chromosome:PapAnu2.0:11:51334306:51382361:-1 gene:ENSPANG00000013149 transcript:ENSPANT00000028591 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGQHVIVLHKIRLAELKQECLARGLETKGIKQDLIHRLQAYLEEHAEEEANEEDVLGDET
EEEETKPIELPVKEEEPPEKTVDVVAEKKVVKITSEIPQTERMQKRAERFNVPVSLESKK
AARAARFGISSVPTKGLSSDNKPMVNLDKLKERAQRFGLNVSSISRKSEDDEKLKKRKER
FGIVTSSAGTGTTEDTEIVSQNERIPAL
Download sequence
Identical sequences ENSPANP00000000556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]