SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000571 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000571
Domain Number 1 Region: 405-460
Classification Level Classification E-value
Superfamily CCCH zinc finger 2.09e-21
Family CCCH zinc finger 0.000029
Further Details:      
 
Domain Number 2 Region: 377-403
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000863
Family CCCH zinc finger 0.00041
Further Details:      
 
Domain Number 3 Region: 349-374
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000955
Family CCCH zinc finger 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000571   Gene: ENSPANG00000021115   Transcript: ENSPANT00000028967
Sequence length 1262
Comment pep:known_by_projection chromosome:PapAnu2.0:19:40362920:40411853:-1 gene:ENSPANG00000021115 transcript:ENSPANT00000028967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPTFRDTSAAVWEDGELEEGELEDDGAEETQDTSGGPERSRKEKGEKHHSDSDEEKSHR
RLKRKRKKEREKEKRRSKKRRKSKHKRHASSSDDFSDFSDDSDFSPSEKGHRKYREYSPP
YAPSHQQYPPSHATPLPKKAYSKMDSKSYGMYEDYENEQYGEYEGDEEEDMGKEDYDDFT
KELNQYRRAKEGSSRGRGSRGRGRGYRGRGSRGGSRGRGMGRGSRGRGRGSMGGDHPEDE
EDFYEEEMDYGESEEPMGDDDYDEYSKELNQYRRSKDGRGRGLSRGRGRGSRGRGKGMGR
GRGRGGSRGGMNKGGMNDDEDFYDEDMGDGGGGSYRSRDHDKPHQQSDKKGKVICKYFVE
GRCTWGDHCNFSHDIELPKKRELCKFYITGFCARAENCPYMHGDFPCKLYHTTGNCINGD
DCMFSHDPLTEETRELLDKMLADDAEAGAEDEKEVEELKKQGINPLPKPPPGVGLLPTPP
RPPGPQAPTSPNGRPMQGGPPPPPPPPPPPPGPPQMPMPVHEPLSPQQLQQQDMYNKKIP
SLFEIVVRPTGQLAEKLGVRFPGPGGPPGPMGPGPNMGPPGPMGGPMHPDMHPDMHPDMH
PDMHPDMHPDMQMGPGMNPGPPMGPGGPPMMPYGPGDSPHSGMMPPIPPAQNFYENFYQQ
QEGMEMEPGLLGDAEDYGHYEELPGEPGEHLFPEHPLEPDSFSEGGPPGRPKPGAGVPDF
LPSAQRALYLRIQQKQQEEEERARRLAESSKQDRENEEGDTGNWYSSDEDEGGSSVTSIL
KTLRQQTSSRPPASVGELSSSGLGDPRLQKGHPTGSRLADPRLSRDPRLTRHAEASGGSG
PGDSGPSDPRLARALPTSKPEGSLHSSPVGPSSSKGSGPPPAEEEEGERALREKAVNIPL
DPLPGHPLRDPRSQLQQFSHIKKDVTLSKPSFARTVLWNPEDLIPLPVPKQDAVPPVPAA
LQSMPTLDPRLHRAATAGPPNARQRPGASTDSSTQGANLPDFELLSRILKTVNATGSSAT
PGSTDKPSDPRVRKAPTDPRLQKPTDSTASSRAAKPSPAEAPSPTASPSGDASPPATAPY
DPRVLAAGGLGQGGGSGQSSVLSGISLYDPRTPNAGGKATEPAADTGAQPKGAEGNGKSS
ASKAKEPPFVRKSALEQPETGKAGADGGAPTDRYNSYNRPRPKAATAPTATTATPPPEGA
PPQPGVHNLPVPTLFGTVKQAPKTGSGSPFAGNSPAREGEQDAASLKDVFKGFDPTASPF
CQ
Download sequence
Identical sequences ENSPANP00000000571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]