SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000578 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000578
Domain Number 1 Region: 53-180
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.67e-46
Family Regulator of G-protein signaling, RGS 0.00000814
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000578   Gene: ENSPANG00000006547   Transcript: ENSPANT00000014577
Sequence length 181
Comment pep:known_by_projection chromosome:PapAnu2.0:1:186283798:186338446:-1 gene:ENSPANG00000006547 transcript:ENSPANT00000014577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDIVIPYNEKPEKPAKTHKPSLDEALQ
WRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEF
IQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELI
K
Download sequence
Identical sequences A0A2I3LRZ5 A0A2K5N0U4 A0A2K5Z6U4 A0A2K6AV63 A0A2K6LZJ3 A0A2K6NFB7 I0FVT2 Q4R5E0
ENSPANP00000000578 NP_001247446.1.72884 NP_001270254.1.63531 XP_010371658.1.97406 XP_011758636.1.29376 XP_011828273.1.47321 XP_011942766.1.92194 XP_017748915.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]