SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000581 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000581
Domain Number 1 Region: 18-85
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.32e-17
Family PHD domain 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000000581
Domain Number - Region: 153-190
Classification Level Classification E-value
Superfamily Recombination protein RecR 0.0615
Family Recombination protein RecR 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000581   Gene: ENSPANG00000009435   Transcript: ENSPANT00000027895
Sequence length 659
Comment pep:known_by_projection chromosome:PapAnu2.0:18:42336579:42341587:-1 gene:ENSPANG00000009435 transcript:ENSPANT00000027895 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGDGSDPEPPDAGEDSKSENGENAPIYCICRKPDINCFMIGCDNCNEWFHGDCIRITEK
MAKAIREWYCRECREKDPKLEIRYRHKKSRERDGNERDSSEPRDEGGGRKRPVPDPDLQR
RAGSGTGVGAMLARGSASPHKSSPQPLVATPSQHHQQQQQIKRSARMCGECEACRRTEDC
GHCDFCRDMKKFGGPNKIRQKCRLRQCQLRARESYKYFPSSLSPVTPSESLPRPRRPLPT
QQQPQPSQKLGRIREDEGAVASSAVKEPPEATATPEPLSDEDLPLDPDLYQDFCAGAFDD
HGLPWMSDTEESPFLDPALRKRAVKVKHVKRREKKSEKKVMERKEERYKRHRQKQKHKDK
WKHPERADAKDPASLPQCLGPGCVRPAQPSSKYCSDDCGMKLAANRIYEILPQRIQQWQQ
SPCIAEEHGKKLLERIRREQQSARTRLQEMERRFHELEAIILRAKQQAVREDEESNEGDS
DDTDLQIFCVSCGHPINPRVALRHMERCYAKYESQTSFGSMYPTRIEGATRLFCDVYNPQ
SKTYCKRLQVLCPEHSRDPKVPADEVCGCPLVRDVFELTGDFCRLPKRQCNRHYCWEKLR
RAEVDLERVRVWYKLDELFEQERNVRTAMTNRAGLLALMLHQTIQHDPLTTDLRSSADR
Download sequence
Identical sequences A0A2J8UEG0
ENSPANP00000000581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]