SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000601 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000601
Domain Number 1 Region: 98-244
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 8.38e-33
Family Glutathione S-transferase (GST), C-terminal domain 0.00000522
Further Details:      
 
Domain Number 2 Region: 26-96
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.12e-17
Family Glutathione S-transferase (GST), N-terminal domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000601   Gene: ENSPANG00000008414   Transcript: ENSPANT00000003707
Sequence length 247
Comment pep:known_by_projection chromosome:PapAnu2.0:X:142603343:142635353:-1 gene:ENSPANG00000008414 transcript:ENSPANT00000003707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGLRPSTQVDPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEE
LKDLAPGTNPPFLVYNKELKTDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKF
SAYIKNTQKEANKNFEKSLLKEFKRLDDYLNTPLLDEIDPDSAEEPTVSRRLFLDGDQLT
LADCSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFTHTCPEDKEIENTYA
SVAKQKS
Download sequence
Identical sequences A0A096MLZ7 A0A0D9R2F3 A0A2K5Z5F0 A0A2K6BK66 G7Q239
ENSPANP00000000601 XP_005595109.1.63531 XP_007991408.1.81039 XP_011716740.1.29376 XP_011827349.1.47321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]