SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000635 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000635
Domain Number 1 Region: 11-72,141-176
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.74e-20
Family FAD/NAD-linked reductases, N-terminal and central domains 0.021
Further Details:      
 
Domain Number 2 Region: 160-334
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000194
Family FAD/NAD-linked reductases, N-terminal and central domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000635   Gene: ENSPANG00000011374   Transcript: ENSPANT00000025201
Sequence length 380
Comment pep:novel chromosome:PapAnu2.0:1:194071300:194079585:1 gene:ENSPANG00000011374 transcript:ENSPANT00000025201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NNYLPMSFSIGINAFKGQYFHSRQYKHPDIFKDKRVLVIGMGNSGTDIAVEASHLAEKVF
LSTTGGGWVISRIFDSRYPWDMVFMTRFQNMLRNSLPTPIVTWLMMRKINNWLNVSSLSM
FLFRTQLKEFVLNDELPGRIITGKVFIRPSIKEVKENSVMFNNTSKEEPIDIIVFATGYT
FAFPFLDESVVKVEDGQASLYKYIFPAHLQKPTLAIIGLIKPLGSMIPTGETQARWAVRV
LKGVNKLPPPSVMIEEINARRENKPSWFGLCYCKALQSDYITYIDELLTYINAKPKLFSM
LLTDPHLALTVFFGPCSPYQFRLTGPGKWEGARNAIMTQWDRTFKVTKGRVVQESPSPFE
SFLKLFSFLALLVAIFLIVL
Download sequence
Identical sequences ENSPANP00000000635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]