SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000643 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000643
Domain Number 1 Region: 21-49,254-274,307-390,425-634
Classification Level Classification E-value
Superfamily ARM repeat 2.97e-30
Family Armadillo repeat 0.036
Further Details:      
 
Domain Number 2 Region: 103-214
Classification Level Classification E-value
Superfamily TPR-like 1.07e-26
Family Tetratricopeptide repeat (TPR) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000643   Gene: ENSPANG00000010676   Transcript: ENSPANT00000007913
Sequence length 668
Comment pep:known_by_projection chromosome:PapAnu2.0:14:102762616:102813929:1 gene:ENSPANG00000010676 transcript:ENSPANT00000007913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDADQEKDLQKFLKNVDEITNLIQEMNSDDPVVQQNAVLETEKRLLLMEEDQEEDECRTT
LNKTVISPPQTAVKSAEEVNSEAFLASVEKDAKERAKRRRENKVLADALKEKGNEAFAEG
NYETAILHYSEGLEKLKDVKVLYTNRAQAYMKLKNYEKTLVDCEWALKCDEKCTKAYFHM
GKVNLALKNYSVSRECYKKILEINPKLQTQVKDYLNQVDLQEKADLQEKEAHELLDSGKN
TAVNTKNLLETLSKPDQIPLFYAGGIEILTEMIKECTEQTLFRMHDGFSIIGDNEVIRRC
FSTAGKDAIEETVCVSVLKLWQAVCRGNEENQRVLVMHPGRARLLATLLSSKVLAIRQQS
LALLLQLAQTESGRSLIISHLDLTRLLEALVSFLDFSDKEANTAMGLFTDLALEERFQVW
FQANLPGVLPALTGILKTDPKVSSSSALCQCIAIMGNLSAEPATRRHMAACEEFGDGCLS
LLARCEENVDLFREVIYTLLGLMMNLCLQAPFVSEVWAVEVSRRCLSLLNSQDGGILTRA
AGVLSRTLSSSLKIVEEALQAGVVKKMMKFLKTGGETASRYAVKILAICTNSYHEAREEV
IRLDKKLSIMMKLLSSEDEVLVGNAALCLGNCMEVPNXXXXXXXXXXXXXXXXXRLTQRR
SHCRKQLS
Download sequence
Identical sequences ENSPANP00000000643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]