SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000662 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000662
Domain Number 1 Region: 720-733,763-1142
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 4.32e-110
Family Formin homology 2 domain (FH2 domain) 0.0000000000189
Further Details:      
 
Domain Number 2 Region: 92-452
Classification Level Classification E-value
Superfamily ARM repeat 8.23e-110
Family Diap1 N-terninal region-like 0.00000000000546
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000000662
Domain Number - Region: 471-550
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.022
Family FCH domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000662   Gene: ENSPANG00000014874   Transcript: ENSPANT00000027597
Sequence length 1240
Comment pep:known_by_projection chromosome:PapAnu2.0:6:135009582:135112482:-1 gene:ENSPANG00000014874 transcript:ENSPANT00000027597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPPGGGLGPGRGTRDKKKGRSPDELPSAGGDGGKSKKFTLKRLMADELERFTSMRIKKE
KEKPNSAHRNSSASYGDDPTAQSLQDVSDEQVLVLFEQMLLDMNLNEEKQQPLREKDIII
KREMVSQYLYTSKAGMSQKESSKSAMMYIQELRSGLRDMPLLSCLESLRVSLNNNPVSWV
QTFGAEGLASLLDILKRLHDEKEETAGSYDSRNKHEIIRCLKAFMNNKFGIKTMLETEEG
ILLLVRAMDPAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEMDEVERFQPLLD
GLKSGTTIALKVGCLQLINALITPAEELDFRVHIRSELMRLGLHQVLQDLREIENEDMRV
QLNVFDEQGEEDSYDLKGRLDDIRMEMDDFNEVFQILLNTVKDSKAEPHFLSILQHLLLV
RNDYEARPQYYKLIEECISQIVLHKNGADPDFKCRHLQIEIEGLIDQMIDKTKVEKSEAK
AAELEKQLDSELTARHELQVEMKKLESDFEQKLQDLQGEKDALHSEKQQIATEKQDLEAE
VSQLTGEVAKLTKELEDAKKEMASLSAAAITVAPSVPSSAAAPPALPLPGDSGTIIPPPP
APGDSTTPPPPPPPPPPPPPPPPPPPLIGSVCISSTPSLPGGTAIPPPPPLPEGASIPPP
PPLPEGASIPPPPPLPGDAGIPPPPPPLPGGAGMPPPPPPLPGGPGIPPPPPFPGGPGIP
PPPPGMGMPPPPPFGFGASAAPVLPFGLTPKKLYKPEVQLRRPNWSKLVAEDLSQDCFWT
KVKEDRFENNELFAKLTLTFSAQTKTKKDQEGGEEKKSVQKKKVKELKVLDSKTAQNLSI
FLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKDEYDDLAESEQ
FGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSESFSSLLEITLL
VGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCENDYPDVLKFPDELA
HVEKASRVSAENLQKNLDQMKKQISDVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQYN
KLRMMHSNMETLYKELGDYFLFDPKKLSVEEFFMDLHNFRNMFLQAVKENQKRRETEEKM
RRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGAAFRRKRGPRQAN
RKAGCAKDDAMAAVPAKVSKKNETFPTILEEAKELVGRAS
Download sequence
Identical sequences ENSPANP00000000662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]