SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000670 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000670
Domain Number 1 Region: 92-272
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.19e-52
Family F-box associated region, FBA 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000670   Gene: ENSPANG00000012371   Transcript: ENSPANT00000005901
Sequence length 275
Comment pep:known_by_projection chromosome:PapAnu2.0:19:33467260:33471030:1 gene:ENSPANG00000012371 transcript:ENSPANT00000005901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEVREGHALGGGMEADGPASPQELPPSPRSPSPPPSPPPLPSPPSLPSPAAPEAPELPE
PEQPSEVHARQLLLEEWGPLSGGLELPPRLTWKLLLLRRPLYRNLLRSPNPEGINIYEPA
PPTGPTQRPLETLGNFRGWYIRTEKLQQNQSWTVKQQCVDLLAEGLWEELLDDEQPDITV
MDWFEDSRLDACVYELHVWLLAADRRSVIAQHHVAPRTSGRGPPGRWVQVSHVFRHYGPG
VRFIHFLHKAKNRMEPGGLRRTRVTDSSVSVQLRE
Download sequence
Identical sequences A0A0A0MU45 A0A2K6CPQ7
ENSMMUP00000018278 ENSPANP00000000670 ENSMMUP00000018278 XP_011763126.1.29376 9544.ENSMMUP00000018278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]