SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000680 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000680
Domain Number 1 Region: 5-236
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.3e-52
Family Ankyrin repeat 0.00012
Further Details:      
 
Domain Number 2 Region: 352-396,431-550
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000233
Family Ankyrin repeat 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000000680
Domain Number - Region: 258-283,327-374
Classification Level Classification E-value
Superfamily TPR-like 0.00147
Family Tetratricopeptide repeat (TPR) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000680   Gene: ENSPANG00000007270   Transcript: ENSPANT00000002325
Sequence length 558
Comment pep:known_by_projection chromosome:PapAnu2.0:6:109311510:109390515:-1 gene:ENSPANG00000007270 transcript:ENSPANT00000002325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLKTAVFNAARDGKLRLLTKLLASKSKEEVSSLISEKTNGATPLLMAARYGHLDMVEFL
LEQCSASIEVGGSVNFDGETIEGAPPLWAASAAGHLKVVQSLLNHGASVNNTTLTNSTPL
RAACFDGHLEIVKYLVEHKADLEVSNRHGHTCLMISCYKGHKEIAQYLLEKGADVNRKSV
KGNTALHDCAESGSLDIMKMLLMYCAKMEKDGYGMTPLLSASVTGHTNIVDFLTHHAQTS
KTERINALELLGATFVDKKRDLLGALKYWKKAMNMRYSDRTNIISKPVPQTLIMAYDYAK
EVNSAEELEGLIADPDEMRMQALLIRERILGPSHPDTSYYIRYRGAVYADSGNFKRCINL
WKYALDMQQSNLDPLSPMTASSLLSFAELFSFMLQDRAKGLLGTTVTFDDLMGILCKSVL
EIERAIKQTQCPADPLQLNKALSIILHLICLLEKVPCTLEQDHFKKQTIYRFLKLHPRGK
NNFSPLHLAVDKNTTCVGRYPVCKFPSLQVTAILIECGADVNVRDSDDNSPLHIAALNNH
PDIMNLLIKSEKERSQKL
Download sequence
Identical sequences ENSPANP00000000680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]