SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000685 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000685
Domain Number 1 Region: 369-492
Classification Level Classification E-value
Superfamily EF-hand 2.57e-53
Family EF-hand modules in multidomain proteins 0.000000564
Further Details:      
 
Domain Number 2 Region: 494-590
Classification Level Classification E-value
Superfamily EF-hand 1.73e-40
Family EF-hand modules in multidomain proteins 0.00000406
Further Details:      
 
Domain Number 3 Region: 570-658
Classification Level Classification E-value
Superfamily RING/U-box 6.24e-22
Family ZZ domain 0.0092
Further Details:      
 
Domain Number 4 Region: 36-162
Classification Level Classification E-value
Superfamily Spectrin repeat 1.08e-17
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 5 Region: 185-323
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-17
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 6 Region: 331-368
Classification Level Classification E-value
Superfamily WW domain 0.00000000000742
Family WW domain 0.00012
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000000685
Domain Number - Region: 7-51
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0532
Family Spectrin repeat 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000685   Gene: ENSPANG00000017371   Transcript: ENSPANT00000011537
Sequence length 969
Comment pep:known_by_projection chromosome:PapAnu2.0:X:28440963:28946881:-1 gene:ENSPANG00000017371 transcript:ENSPANT00000011537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPRKEKAPRDSKGVKELMKQWQDLQGEIEAHTDVYHNLDENSQKVLRSLEGSDDAVLLQ
RRLDNMNFKWSELRKKSLNIRSHLEASSDQWKRLHLSLQELLVWLQLKDDELSRQTPIGG
DFPAVQKQNDVHRAFKRELKTKEPVIMSTLETVRIFLTEQPLEGLEKLYQEPRELPPEER
AQNVTRLLRKQAEEVNTEWEKLNLHSTDWQRKIDETLERLQELQEATDELDLKLRQAEVI
KGSWQPVGDLLIDSLQDHLEKVKALRGEIAPLKENVSHVNDLARQLTTLGIQLSPYNLST
LEDLNTRWKLLQVAVEDRVRQLHEAHRDFGPASQHFLSTSVQGPWERAISPNKVPYYINH
ETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLSAACDALDQH
NLKQNDQPMDILQIINCLTTIYDRLEQEHNNLVNVPLCVDMCLNWLLNVYDTGRTGRIRV
LSFKTGIISLCKAHLEDKYRYLFKQVSSSTGFCDQRRLGLLLHDSIQIPRQLGEVASFGG
SNIEPSVRSCFQFANNKPEIEAALFLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNIC
KECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMHYPMVEYCTPTTSGEDVRDFAKVL
KNKFRTKRYFAKHPRMGYLPVQTVLEGDNMETPVTLINFWPVDSAPASSPQLSHDDTHSR
IEHYASRLAEMENSNGSYLNDSISPNESIDDEHLLIQHYCQSLNQDSPLSQPRSPAQILI
SLESEERGELERILADLEEENRNLQAEYDRLKQQHEHKGLSPLPSPPEMMPTSPQSPRDA
ELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQPQAEAKVNGTTVSSPST
SLQRSDSSQPMLLRVVGSQTSDSMGEEDVLSPPQDTSTGLEEVMEQLNNSFPSSRGRNTP
GKPMREDTM
Download sequence
Identical sequences ENSPANP00000000685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]