SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000707 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000707
Domain Number 1 Region: 425-634
Classification Level Classification E-value
Superfamily TPR-like 1.88e-38
Family Tetratricopeptide repeat (TPR) 0.0014
Further Details:      
 
Domain Number 2 Region: 637-810
Classification Level Classification E-value
Superfamily TPR-like 4.93e-27
Family Tetratricopeptide repeat (TPR) 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000000707
Domain Number - Region: 388-437
Classification Level Classification E-value
Superfamily S-adenosylmethionine decarboxylase 0.0318
Family S-adenosylmethionine decarboxylase 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000707   Gene: ENSPANG00000013680   Transcript: ENSPANT00000020360
Sequence length 836
Comment pep:known_by_projection chromosome:PapAnu2.0:11:28949542:29213278:-1 gene:ENSPANG00000013680 transcript:ENSPANT00000020360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPFYFHAVNVILHCLVTLVLMYTCDKTVFKNRGLAFVTALLFAVHPIHTEAVAGIVGRA
DVLACLLFLLAFLSYNRSLDQGCVGESFPSTVSPFFLLFSLFLGTCAMLVKETGITVFGV
CLVYDLFSLSNKEDKSSNGALCPCSPQQPGSPQPSSLPGHPHRENGKQQRFPHKGAWGGC
HSPLPPEPKSSGFPVSPRAVWSMMRYLRASSNRNFLLTMRPFLKRAILVLSYVLVILYFR
LWIMGGSMPLFSEQDNPASFSPYILTRFLTYSYLLAFNVWLLLAPVTLCYDWQVGSIPLV
ETIWDMRNLATILLAVVMALLSLHCLAAFKRLEHKEVLVGLLFLVFPFIPASNLFFRVGF
VVAERVLYMPSMGYCILFVHGLSKLCTWLNRCGATTLIVSTVLLLLLFSWKTVKQNEIWL
SRESLFRSGVQTLPHNAKVHYNYANFLKDQGRNKEAIYHYRTALKLYPRHASALNNLGTL
IRDTAEAKMYYQKALQLHPQHNRALFNLGNLLKSQEKKEEAITLLKDSIKYGPEFADAYS
SLASLLAEQERFKEAEEIYQAGIKNCPDSSDLHNNYGVFLVDTGLPEKAVAHYQQAIKLS
PSHHVAMVNLGRLYRSLGENSMAEEWYKRALQVAHKAEILSPLGALYYNTGRYEEALQIY
QEAAALQPSQRELRLALAQVLAVMGQTKEAEKMTNHIVSEETGCLECYRLLSAIYSKQEN
HDKALDVIDKALQLKPKDPKVISELFFTKGNQLREQNLLDKAFESYRAAVQLNPDQAQAW
MNMGGIQHIKGKYVSARAYYERALQLVPDSKLLKENLAKLDRLEKRLQEVREKDQT
Download sequence
Identical sequences ENSPANP00000000707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]