SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000710 from Papio anubis 76

(show help)
Strong hits

Sequence:	ENSPANP00000000710
Domain Number 1	Region: 135-165
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.00000000000000342
Family	LIM domain	0.00077
Further Details:

Domain Number 2	Region: 69-101
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.00000000000499
Family	LIM domain	0.001
Further Details:

Domain Number 3	Region: 104-134
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.00000000000749
Family	LIM domain	0.0013
Further Details:

Domain Number 4	Region: 39-69
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.00000000263
Family	LIM domain	0.0012
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

External link(s)	Protein: ENSPANP00000000710 Gene: ENSPANG00000010805 Transcript: ENSPANT00000007998
Sequence length	186
Comment	pep:known_by_projection chromosome:PapAnu2.0:1:88004944:88139069:1 gene:ENSPANG00000010805 transcript:ENSPANT00000007998 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MWPSGKLAAKTPERQAHNTQTMVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAM DSYWHSRCLKCSCCQAQLGDIGTSCYTKSGMILCRNDYIRLFGNSGACSACGQSIPASEL VMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHDRPTALINGHLNSLQSNPLL PDQKVC
Download sequence
Identical sequences	ENSPANP00000000710

SEARCH