SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000717 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000717
Domain Number 1 Region: 30-141
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-38
Family Spermadhesin, CUB domain 0.00016
Further Details:      
 
Domain Number 2 Region: 145-253
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-35
Family Spermadhesin, CUB domain 0.00039
Further Details:      
 
Domain Number 3 Region: 263-369
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-31
Family Spermadhesin, CUB domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000717   Gene: ENSPANG00000015482   Transcript: ENSPANT00000014147
Sequence length 445
Comment pep:known_by_projection chromosome:PapAnu2.0:1:56354435:56368954:-1 gene:ENSPANG00000015482 transcript:ENSPANT00000014147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAEQGACLLLAVALLGPGPRAQAMEGVKCGGVLSAPSGNFSSPNFPRLYPYNTECSWLI
VVAEGSSVLLTFHAFDLEYHDTCSFDFLEIYNGASPDKGNLLGRFCGKVPPPPFTSSWHV
MSVVFHSDKHVASHGFSAGYQKDVCGGVLTGLSGVLTSPEYPNNYPNSMECHWVIRAAGP
ASVKLVFVDFQVEGNEECTYDYVAVLGGPGPTRGHHYCGSTRPPTLVSLGHELQVIFKSD
FNIGGRGFKAYYFSGQCQEVYMTMRGNFSSPRYPSSYPNNIRCHWTIRLPPGYRVKVFFL
DLDLEEPNSLTKTCDFDHLAAFDGASEEAPLLGNWCGHHLPPPVTSSHNQLLLLHTDRST
TRRGFSVAYIGGQLGCGSGSTEGEGEALQPQSLQPLSSILPVCPPPMNGLLQCLFRWLYP
CPLSGPLRLDGTAPACFHYCRASFP
Download sequence
Identical sequences ENSPANP00000000717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]